Klicka på tjurens namn för bild och mer information. Skriv ut listan

Land USAUSAUSAUSAUSAUSAUSAUSA Land
Namn COPYCATADVANCEMITCHELLFERDINANDMORGANKING BOYMOGULDRAGONHEART Namn
Far JediJosuperTatumMontrossBookemMcCutchenDorcyEpic Far
Morfar JaceyMogulMogulMogulShottleSuperMarshPlanet Morfar
Stbnr 9250492438925059229492295921449119292169 Stbnr
Kodnr 9-77439-77079-77449-76679-76769-75829-32929-3891 Kodnr
Bedömning GenomiskGenomiskGenomiskGenomiskUSA LbsUSA LbsUSA LbsUSA Lbs Bedömning
Mjölk +1425+1782+1967+2416+1577+1373+1236+1869 Mjölk
Protein +61+73+57+74+54+43+40+43 Protein
Protein % +0.06+0.06-0.01+0.00+0.02+0.00+0.01-0.05 Protein %
Fett +77+95+84+64+63+49+78+49 Fett
Fett % +0.09+0.11+0.04-0.09+0.02-0.01+0.11-0.07 Fett %
Säkerhet 76%80%80%80%99%99%99%94% Säkerhet
SCR +2.4+1+1.3+0.9+1.7-0.9+2.8 SCR
TYP +2.47+1.96+2.67+2.42+1.53+3.25+2.2+1.87 TYP
JUVER +2.22+2.17+2.41+2.72+1.18+2.65+3.09+2.24 JUVER
BEN +1.82+1.26+1.7+1.88+1.02+1.26+2.29+1.01 BEN
Säkerhet 76%79%78%79%98%99%99%87% Säkerhet
Storlek +1.68 reslig+1.47 reslig+2.21 reslig+0.64 reslig+0.41 reslig+2.89 reslig+0.47 reslig+1.47 reslig Storlek
Styrka +2.31 stark+0.65 stark+0.94 stark+1.40 stark+0.63 stark+2.11 stark+0.24 stark-0.31 vek Styrka
Kroppsdjup +1.56 djup+0.64 djup+1.40 djup+1.13 djup+0.55 djup+2.09 djup+0.51 djup0.00 Kroppsdjup
Mjölkpräglad +0.61 öppen+1.53 öppen+2.69 öppen+1.55 öppen+0.77 öppen+1.97 öppen+1.57 öppen+1.50 öppen Mjölkpräglad
Korsluttning -0.33 höga bärben-0.08 höga bärben-0.32 höga bärben+0.17 sluttande-1.83 höga bärben-0.97 höga bärben+0.32 sluttande+1.67 sluttande Korsluttning
Korsbredd +1.32 brett+1.27 brett+2.15 brett-0.12 smalt+0.97 brett+3.12 brett+0.20 brett+0.90 brett Korsbredd
Benvinkel -1.51 rak+0.27 vinklad-0.53 rak-1.60 rak+0.73 vinklad-0.14 rak-2.54 rak+0.73 vinklad Benvinkel
Ben bakifrån +2.02 parallell+1.29 parallell+2.15 parallell+1.88 parallell+0.62 parallell+1.56 parallell+2.65 parallell+0.62 parallell Ben bakifrån
Kotvinkel +2.49 hög+1.28 hög+2.28 hög+2.40 hög+1.26 hög+2.31 hög+2.52 hög+0.90 hög Kotvinkel
Framjuver +2.64 starkt+2.23 starkt+2.61 starkt+3.24 starkt+2.28 starkt+3.58 starkt+3.40 starkt+1.47 starkt Framjuver
B-juverhöjd +3.24 högt+3.87 högt+4.33 högt+4.34 högt+1.30 högt+4.19 högt+4.47 högt+3.67 högt B-juverhöjd
B-juverbredd +2.98 brett+3.56 brett+3.98 brett+3.99 brett+1.20 brett+3.85 brett+4.11 brett+3.38 brett B-juverbredd
Juverligamen +1.67 starkt+0.46 starkt+1.39 starkt+0.13 starkt+0.23 starkt+1.94 starkt+0.71 starkt+1.98 starkt Juverligamen
Juverdjup +1.69 grunt+1.74 grunt+1.18 grunt+1.02 grunt+1.26 grunt+2.07 grunt+1.82 grunt+1.77 grunt Juverdjup
Spenplac. fram +0.83 tät-0.02 vid+0.33 tät+0.54 tät+0.38 tät+1.32 tät+1.57 tät+0.29 tät Spenplac. fram
Spenplac. bak +1.24 tät-0.25 vid+0.59 tät-0.14 vid-0.27 vid+0.98 tät+1.24 tät+0.33 tät Spenplac. bak
Spenlängd +0.18 lång-1.81 kort+0.23 lång-0.11 kort+0.76 lång+0.87 lång-1.62 kort-0.18 kort Spenlängd
Kalvning Far (MF) 7.6% (5.4%)7.8% (5.5%)8.3% (5.9%)7.2% (6.0%)7.0% (4.9%)8.4% (4.1%)6.0% (4.1%)5.9% (5.8%) Kalvning Far
Celltal 2.742.882.963.042.802.703.002.91 Celltal
Mjölkhastighet +98+103+105+105+99+94+110+104 Mjölkhastighet
FI +4.4+1.4+2.5+1.9+3+2.7+0.4+2.1 FI
PL +8+6.8+5.4+5.3+7+4.4+3.9+7.5 PL
TPI 28272779267426682560255225032465 TPI
Pris Sexad 520 kr420 kr390 kr460 kr450 kr440 kr490 kr420 kr Pris Sexad
Pris 260 kr190 kr240 kr240 kr340 kr310 kr240 kr Pris